Skip to content
thepilatesfinder
Find another studio
No photo yet

Truform - Hot Mat Pilates & Fitness Studio, Mayfair

16 Berkeley St, London, W1J 8DZ

matstep-freeindependentweekends

See the current listing

Is this your studio?

Claiming is free and takes about two minutes. Then the listing is yours to run. Why bother claiming?

Use an address at the studio’s own domain if you have one. It is the fastest way for us to confirm the claim is genuine.